missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MCF2L Partial ORF (AAH20208, 220 a.a. - 319 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023263-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Sequence: GTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLSpecifications
AAH20208 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
GTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCL | |
RUO | |
MCF2L | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
23263 | |
MCF2L (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ARHGEF14/DBS/FLJ12122/KIAA0362/OST | |
MCF2L | |
Recombinant | |
wheat germ expression system |