Learn More
Abnova™ Human MAPKSP1 Partial ORF (NP_068805, 1 a.a. - 87 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008649-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Multiple transcript variants are expressed by this gene, but only one variant is thought to express a protein. [provided by RefSeq]
Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPSpecifications
NP_068805 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.31kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP | |
RUO | |
MAPKSP1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
8649 | |
MAPKSP1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MAP2K1IP1/MAPBP/MP1 | |
MAPKSP1 | |
Recombinant | |
wheat germ expression system |