missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LOH12CR1 Full-length ORF (NP_477517.1, 1 a.a. - 196 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human LOH12CR1 Full-length ORF (NP_477517.1, 1 a.a. - 196 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16147423
Price: 335.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00118426-P01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16147423

335.00€ / 10µg

Quantity

Estimated Shipment: 13-06-2024
to see stock.

Add to basket

Description

Sequence: MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL

Specifications

Accession Number	NP_477517.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	48.6kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	LOH1CR12
Gene Symbol	LOH12CR1
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	118426
Name	LOH12CR1 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL
Regulatory Status	RUO
Common Name	LOH12CR1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Product Suggestions

Abnova™ Human LOH12CR1 Full-length ORF (NP_477517.1, 1 a.a. - 196 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers