Learn More
Abnova™ Human LHX3 Partial ORF (NP_055379, 228 a.a. - 316 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008022-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Sequence: RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPSpecifications
NP_055379 | |
Liquid | |
8022 | |
LHX3 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp762A2013/LIM3/M2-LHX3 | |
LHX3 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.53kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP | |
RUO | |
LHX3 | |
Wheat Germ (in vitro) | |
GST |