missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LGALS7 Full-length ORF (NP_002298.1, 1 a.a. - 136 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_002298.1 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 3963 |
| Molecular Weight (g/mol) | 41.5kDa |
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantity | Prix | Quantité et disponibilité | |||||
|
16157381
|
Abnova™
H00003963-P01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 07-06-2024
Log in to see stock. |
|||||
|
16167381
|
Abnova™
H00003963-P01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 07-06-2024
Log in to see stock. |
|||||
Description
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq]
Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIFSpécification
| NP_002298.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 41.5kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF | |
| RUO | |
| LGALS7 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 3963 | |
| LGALS7 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GAL7/LGALS7A | |
| LGALS7 | |
| Recombinant | |
| wheat germ expression system |