missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LEF1 Partial ORF (NP_057353, 33 a.a. - 138 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051176-Q03.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16156696

  • 545.00€ / 25µg

Estimated Shipment: 24-08-2022
to see stock.
Add to basket

Description

Description

LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]).[supplied by OMIM]

Sequence: QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT
Specifications

Specifications

NP_057353
Liquid
51176
LEF1 (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp586H0919/TCF1ALPHA
LEF1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue
QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT
RUO
LEF1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers