Learn More
Abnova™ Human LEF1 Partial ORF (NP_057353, 33 a.a. - 138 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00051176-Q03.25ug
Additional Details : Weight : 0.00010kg
Description
LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]).[supplied by OMIM]
Sequence: QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSpecifications
NP_057353 | |
Liquid | |
51176 | |
LEF1 (Human) Recombinant Protein (Q03) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp586H0919/TCF1ALPHA | |
LEF1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.29kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT | |
RUO | |
LEF1 | |
Wheat Germ (in vitro) | |
GST |