missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KNG1 Partial ORF (NP_000884.1, 322 a.a. - 427 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003827-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
High molecular weight kininogen (HMWK) plays an important role in assembly of the plasma kallikrein (see MIM 147910)-kinin system. The KNG1 gene generates both HMWK and low molecular weight kininogen (LMWK) through alternative splicing. Both HMWK and LMWK contain an identical heavy chain consisting of protein domains 1, 2, and 3. However, HMWK contains a 56-kD light chain that consists of domains 5 and 6H, whereas LMWK contains a unique 4-kD light chain that consists of domain 5L. In both proteins, the heavy and light chains are linked by domain 4, which contains the bradykinin (BK) nonapeptide. BK, which is released by plasma kallikrein, is a potent inflammatory mediator that causes vasodilation and enhanced capillary permeability, induces pain, and stimulates production of nitric oxide and prostacyclin (see MIM 601699) from endothelial cells. During vascular damage, BK stimulates smooth muscle proliferation and intimal hypertrophy. Release of BK from HMWK generates a 2-chain HMWK, termed HMWKa, containing the heavy and light chains joined by a disulfide bond (Merkulov et al., 2008 [PubMed 18000168]).[supplied by OMIM]
Sequence: VARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVSSpecifications
| NP_000884.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.4kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVS | |
| RUO | |
| KNG1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3827 | |
| KNG1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BDK/KNG | |
| KNG1 | |
| Recombinant | |
| wheat germ expression system |