missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KCNK12 Partial ORF (NP_071338, 166 a.a. - 215 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marque: Abnova™ H00056660-Q01.25ug
Informations supplémentaires : Weight : 0.00010kg
Description
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. [provided by RefSeq]
Sequence: ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHSpécification
| NP_071338 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.24kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYH | |
| RUO | |
| KCNK12 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 56660 | |
| KCNK12 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| THIK-2/THIK2 | |
| KCNK12 | |
| Recombinant | |
| wheat germ expression system |