missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KCNC3 Partial ORF (NP_004968, 671 a.a. - 757 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003748-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100375

  • 335.00€ / 10µg
Estimated Shipment: 21-08-2024
to see stock.
Add to basket

Description

Description

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. [provided by RefSeq]

Sequence: ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Specifications

Specifications

NP_004968
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.31kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
RUO
KCNC3
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
3748
KCNC3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KSHIIID/KV3.3/SCA13
KCNC3
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers