Learn More
Abnova™ Human ITGA2 Partial ORF (NP_002194.2, 30 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003673-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling. [provided by RefSeq]
Sequence: YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILSpecifications
NP_002194.2 | |
Liquid | |
3673 | |
ITGA2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BR/CD49B/GPIa/VLA-2/VLAA2 | |
ITGA2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.53kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL | |
RUO | |
ITGA2 | |
Wheat Germ (in vitro) | |
GST |