missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IRX6 Partial ORF (NP_077311, 337 a.a. - 446 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00079190-Q01.25ug

Weitere Details : Weight : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16159976

  • 545.00€ / 25µg

Estimated Shipment: 29-07-2022
to see stock.
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: PRLTMHYPCLEKPRIWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGLPLNCAPCPRRSEPVVQCQYPSGAEAG
Spezifikation

Spezifikation

NP_077311
Liquid
79190
IRX6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IRX-3/IRX7/IRXB3
IRX6
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue
PRLTMHYPCLEKPRIWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGLPLNCAPCPRRSEPVVQCQYPSGAEAG
RUO
IRX6
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote