missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IMMP1L Full-length ORF (NP_659418.1, 1 a.a. - 166 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00196294-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16159163

  • 359.00€ / 10µg

Estimated Shipment: 29-07-2022
to see stock.
Add to basket

Description

Description

The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM]

Sequence: MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
Specifications

Specifications

NP_659418.1
Liquid
196294
IMMP1L (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
RUO
IMMP1L
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44.9kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ25059/IMP1/IMP1-LIKE
IMMP1L
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers