missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IHPK2 Partial ORF (NP_001005912.1, 1 a.a. - 70 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00051447-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Sequence: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVSSpecifications
| NP_001005912.1 | |
| Liquid | |
| 51447 | |
| IHPK2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| IHPK2/PiUS | |
| IP6K2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.44kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVS | |
| RUO | |
| IP6K2 | |
| Wheat Germ (in vitro) | |
| GST |