missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IFI16 Partial ORF (AAH17059, 630 a.a. - 729 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | AAH17059 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 3428 |
| Molecular Weight (g/mol) | 36.74kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16106581
|
Abnova™
H00003428-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 07-06-2024
Log in to see stock. |
|||||
|
16116581
|
Abnova™
H00003428-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 07-06-2024
Log in to see stock. |
|||||
Description
This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. [provided by RefSeq]
Sequence: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFFSpecifications
| AAH17059 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| IFNGIP1/MGC9466/PYHIN2 | |
| IFI16 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3428 | |
| IFI16 (Human) Recombinant Protein (Q01) | |
| FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF | |
| RUO | |
| IFI16 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |