Learn More
Abnova™ Human ICMT Partial ORF (NP_036537, 86 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023463-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined. [provided by RefSeq]
Sequence: SQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKSpecifications
NP_036537 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.33kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELK | |
RUO | |
ICMT | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
23463 | |
ICMT (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HSTE14/MGC39955/MST098/MSTP098/PCCMT/PCMT/PPMT | |
ICMT | |
Recombinant | |
wheat germ expression system |