missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HSD17B3 Partial ORF (NP_000188, 29 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003293-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16159644

  • 545.00€ / 25µg

Estimated Shipment: 09-08-2022
to see stock.
Add to basket

Description

Description

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq]

Sequence: RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK
Specifications

Specifications

NP_000188
Liquid
3293
HSD17B3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EDH17B3/SDR12C2
HSD17B3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.75kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK
RUO
HSD17B3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers