missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HOXA7 Partial ORF (NP_008827, 58 a.a. - 112 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003204-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq]
Sequence: NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGASpecifications
| NP_008827 | |
| Liquid | |
| 3204 | |
| HOXA7 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ANTP/HOX1/HOX1.1/HOX1A | |
| HOXA7 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.79kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA | |
| RUO | |
| HOXA7 | |
| Wheat Germ (in vitro) | |
| GST |