missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GULP1 Full-length ORF (AAH01103.1, 1 a.a. - 167 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051454-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120053

  • 545.00€ / 25µg

Estimated Shipment: 27-09-2022
to see stock.
Add to basket

Description

Description

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, inflammation, and autoimmunity. CED6 is an evolutionarily conserved adaptor protein required for efficient engulfment of apoptotic cells by phagocytes.[supplied by OMIM]

Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCVSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL
Specifications

Specifications

AAH01103.1
Liquid
51454
GULP1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCVSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL
RUO
GULP1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
45.8kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CED-6/CED6/FLJ31156/GULP
GULP1
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers