missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GIPC1 Partial ORF (NP_005707, 61 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010755-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16105662

  • 335.00€ / 10µg
Estimated Shipment: 26-08-2024
to see stock.
Add to basket

Description

Description

GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM]

Sequence: HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK
Specifications

Specifications

NP_005707
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK
RUO
GIPC1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
10755
GIPC1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C19orf3/GIPC/GLUT1CBP/Hs.6454/IIP-1/MGC15889/MGC3774/NIP/RGS19IP1/SEMCAP/SYNECTIIN/SYNECTIN/TIP-2
GIPC1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers