missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GIPC1 Partial ORF (NP_005707, 61 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010755-Q01.10ug
This item is not returnable.
View return policy
Description
GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM]
Sequence: HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKSpecifications
| NP_005707 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.52kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK | |
| RUO | |
| GIPC1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10755 | |
| GIPC1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C19orf3/GIPC/GLUT1CBP/Hs.6454/IIP-1/MGC15889/MGC3774/NIP/RGS19IP1/SEMCAP/SYNECTIIN/SYNECTIN/TIP-2 | |
| GIPC1 | |
| Recombinant | |
| wheat germ expression system |