missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GATA5 Partial ORF (NP_536721, 336 a.a. - 397 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00140628-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161947

  • 359.00€ / 10µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq]

Sequence: PVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
Specifications

Specifications

NP_536721
Liquid
140628
GATA5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
bB379O24.1
GATA5
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.56kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
RUO
GATA5
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers