missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ERP29 Partial ORF (NP_006808.1, 39 a.a. - 138 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_006808.1 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 10961 |
| Molecular Weight (g/mol) | 36.74kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16103446
|
Abnova™
H00010961-Q01.10ug |
10 ug |
335.00€
10µg |
Estimated Shipment: 15-10-2024
Log in to see stock. |
|||||
|
16113446
|
Abnova™
H00010961-Q01.25ug |
25 ug |
508.00€
25µg |
Estimated Shipment: 15-10-2024
Log in to see stock. |
|||||
Description
This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Sequence: LPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVSpecifications
| NP_006808.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C12orf8/ERp28/ERp31/PDI-DB | |
| ERP29 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10961 | |
| ERP29 (Human) Recombinant Protein (Q01) | |
| LPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKV | |
| RUO | |
| ERP29 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |