missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ENTPD6 Partial ORF (NP_001238, 386 a.a. - 484 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000955-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPASSpecifications
| NP_001238 | |
| Liquid | |
| 955 | |
| ENTPD6 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD39L2/DKFZp781G2277/DKFZp781K21102/FLJ36711/IL-6SAG/IL6ST2/NTPDase-6/dJ738P15.3 | |
| ENTPD6 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS | |
| RUO | |
| ENTPD6 | |
| Wheat Germ (in vitro) | |
| GST |