missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EIF4EBP2 Partial ORF (NP_004087, 61 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001979-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq]
Sequence: DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDISpecifications
| NP_004087 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.34kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI | |
| RUO | |
| EIF4EBP2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1979 | |
| EIF4EBP2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 4EBP2/PHASII | |
| EIF4EBP2 | |
| Recombinant | |
| wheat germ expression system |