Learn More
Abnova™ Human EIF2AK4 Partial ORF (AAH09350, 730 a.a. - 829 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00440275-Q02.10ug
Additional Details : Weight : 0.00010kg
Description
EIF2AK4 belongs to a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2S1; MIM 603907) to downregulate protein synthesis in response to varied cellular stresses (Berlanga et al., 1999 [PubMed 10504407]).[supplied by OMIM]
Sequence: YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILFSpecifications
AAH09350 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.41kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF | |
RUO | |
EIF2AK4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
440275 | |
EIF2AK4 (Human) Recombinant Protein (Q02) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GCN2/KIAA1338 | |
EIF2AK4 | |
Recombinant | |
wheat germ expression system |