missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EIF1AY Partial ORF (NP_004672, 31 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009086-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16159885

  • 545.00€ / 25µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq]

Sequence: DGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
Specifications

Specifications

NP_004672
Liquid
9086
EIF1AY (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EIF1AY
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
RUO
EIF1AY
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers