missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EDG3 Partial ORF (NP_005217.2, 302 a.a. - 378 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001903-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq]
Sequence: SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCNSpecifications
| NP_005217.2 | |
| Liquid | |
| 1903 | |
| EDG3 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EDG-3/EDG3/FLJ37523/FLJ93220/LPB3/MGC71696/S1P3 | |
| S1PR3 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.21kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN | |
| RUO | |
| S1PR3 | |
| Wheat Germ (in vitro) | |
| GST |