missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRH Partial ORF (AAH11031, 154 a.a. - 196 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001392-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123501

  • 545.00€ / 25µg

Estimated Shipment: 20-09-2022
to see stock.
Add to basket

Description

Description

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition. [provided by RefSeq]

Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Specifications

Specifications

AAH11031
Liquid
1392
CRH (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CRF
CRH
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
30.47kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
RUO
CRH
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers