missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CPNE5 Partial ORF (NP_065990, 393 a.a. - 450 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifications
| Accession Number | NP_065990 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 57699 |
| Molecular Weight (g/mol) | 32.12kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16159236
|
Abnova™
H00057699-Q01.25UG |
25 ug |
508.00€
25µg |
Estimated Shipment: 06-06-2024
Log in to see stock. |
|||||
|
16149236
|
Abnova™
H00057699-Q01.10UG |
10 ug |
335.00€
10µg |
Estimated Shipment: 06-06-2024
Log in to see stock. |
|||||
Description
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. [provided by RefSeq]
Sequence: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQDSpecifications
| NP_065990 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.12kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| COPN5/CPN5/DKFZp666C234/KIAA1599 | |
| CPNE5 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 57699 | |
| CPNE5 (Human) Recombinant Protein (Q01) | |
| RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD | |
| RUO | |
| CPNE5 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |