missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLTA Partial ORF (NP_001824.1, 118 a.a. - 176 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001211-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Sequence: MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSSpecifications
| NP_001824.1 | |
| Liquid | |
| 1211 | |
| CLTA (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| LCA | |
| CLTA | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.23kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS | |
| RUO | |
| CLTA | |
| Wheat Germ (in vitro) | |
| GST |