missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CLDN5 Partial ORF (NP_003268, 29 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007122-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16166775

  • 359.00€ / 10µg

Estimated Shipment: 20-09-2022
to see stock.
Add to basket

Description

Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Specifications

Specifications

NP_003268
Liquid
7122
CLDN5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AWAL/BEC1/CPETRL1/TMVCF
CLDN5
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.57kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
RUO
CLDN5
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers