missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CHIC2 Partial ORF (NP_036242, 21 a.a. - 84 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00026511-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the CHIC family of proteins. The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq]
Sequence: QLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRSpecifications
| NP_036242 | |
| Liquid | |
| 26511 | |
| CHIC2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BTL/MGC21173 | |
| CHIC2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.78kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR | |
| RUO | |
| CHIC2 | |
| Wheat Germ (in vitro) | |
| GST |