missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CETN2 Partial ORF (NP_004335, 85 a.a. - 172 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001069-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123131

  • 545.00€ / 25µg

Estimated Shipment: 13-09-2022
to see stock.
Add to basket

Description

Description

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq]

Sequence: NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Specifications

Specifications

NP_004335
Liquid
1069
CETN2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CALT/CEN2
CETN2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
RUO
CETN2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers