missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CDC91L1 Partial ORF (NP_536724, 101 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00128869-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. [provided by RefSeq]
Sequence: DFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTSpecifications
| NP_536724 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.89kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNT | |
| RUO | |
| PIGU | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 128869 | |
| CDC91L1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CDC91L1/GAB1/MGC40420 | |
| PIGU | |
| Recombinant | |
| wheat germ expression system |