missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CCRK Partial ORF (AAH02655.1, 183 a.a. - 257 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023552-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase activates CDK2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]
Sequence: FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIASpecifications
| AAH02655.1 | |
| Liquid | |
| 23552 | |
| CCRK (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CDCH/p42 | |
| CCRK | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.88kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA | |
| RUO | |
| CCRK | |
| Wheat Germ (in vitro) | |
| GST |