missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CCL18 Partial ORF (NP_002979, 21 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006362-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq]
Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNASpecifications
| NP_002979 | |
| Liquid | |
| 6362 | |
| CCL18 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AMAC-1/AMAC1/CKb7/DC-CK1/DCCK1/MIP-4/PARC/SCYA18 | |
| CCL18 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.33kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA | |
| RUO | |
| CCL18 | |
| Wheat Germ (in vitro) | |
| GST |