Learn More
Abnova™ Human C1QTNF5 Partial ORF (NP_056460.1, 145 a.a. - 243 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00114902-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
A bicistronic transcript encodes the products of the membrane frizzled-related gene and the complement C1q tumor necrosis factor-related gene 5, located on chromosome 11
Sequence: CQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFASpecifications
NP_056460.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
CQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA | |
RUO | |
C1QTNF5 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
114902 | |
C1QTNF5 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CTRP5/DKFZp586B0621/LORD | |
C1QTNF5 | |
Recombinant | |
wheat germ expression system |