missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ATM Partial ORF (AAH07023, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000472-Q01.10ug
Additional Details : Weight : 0.00010kg
Beschreibung
The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: MTLHEPANSSASQSTDLCDFSGDLDPAPNPPHFPSHVVKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILKIYHLFVSLSpezifikation
| AAH07023 | |
| Liquid | |
| 472 | |
| ATM (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AT1/ATA/ATC/ATD/ATDC/ATE/DKFZp781A0353/MGC74674/TEL1/TELO1 | |
| ATM | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MTLHEPANSSASQSTDLCDFSGDLDPAPNPPHFPSHVVKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILKIYHLFVSL | |
| RUO | |
| ATM | |
| Wheat Germ (in vitro) | |
| GST |
Sicherheit und Handhabung
Produktidentifikator
Signalwort
Gefahrenkategorie
Gefahrenhinweis
Sicherheitshinweis
Ergänzende Informationen
- ATM (Human) Recombinant Protein (Q01)
Signalwort
- Warning
Gefahrenkategorie
- Acute toxicity Category 4
- Serious eye damage/eye irritation Category 2
- Skin corrosion/irritation Category 2
Gefahrenhinweis
- H302-Harmful if swallowed.
- H315-Causes skin irritation.
- H319-Causes serious eye irritation.
Sicherheitshinweis
- P102-Keep out of reach of children.
- P103-Read label before use.
- P233-Keep container tightly closed.
- P264-Wash hands thoroughly after handling.
- P270-Do not eat, drink or smoke when using this product.
- P280-Wear protective gloves/protective clothing/eye protection/face protection.
- P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
- P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
- P404-Store in a closed container.
- P405-Store locked up.
- P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
Ergänzende Informationen
- MIXTURE LIST-Contains : tris-HCl, reduced glutathione