Learn More
Abnova™ Human ATG16L1 Partial ORF (-, 459 a.a. - 541 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00055054-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM]
Sequence: SGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKSpecifications
Antibody Production, ELISA, Protein Array, Western Blot | |
55054 | |
ATG16L1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
APG16L/ATG16L/FLJ00045/FLJ10035/FLJ10828/FLJ22677/IBD10/WDR30 | |
ATG16L1 | |
Recombinant | |
wheat germ expression system |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.76kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGK | |
RUO | |
ATG16L1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |