missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARL9 Full-length ORF (NP_996802.1, 1 a.a. - 123 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00132946-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16157983

  • 545.00€ / 25µg

Estimated Shipment: 29-07-2022
to see stock.
Add to basket

Description

Description

ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM]

Sequence: MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ
Specifications

Specifications

NP_996802.1
Liquid
132946
ARL9 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARL9
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.2kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ARL9
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers