missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human APOC2 Full-length ORF (ENSP00000252490, 1 a.a. - 101 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000344-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16164764

  • 545.00€ / 25µg

Estimated Shipment: 02-08-2022
to see stock.
Add to basket

Description

Description

The protein encoded by this gene is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. [provided by RefSeq]

Sequence: MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Specifications

Specifications

ENSP00000252490
Liquid
344
APOC2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC75082
APOC2
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
APOC2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers