missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AP3S2 Full-length ORF (NP_005820.1, 1 a.a. - 193 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010239-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16194702

  • 508.00€ / 25µg
Estimated Shipment: 28-08-2024
to see stock.
Add to basket

Description

Description

Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
Specifications

Specifications

NP_005820.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
48.4kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
AP3S2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
10239
AP3S2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AP3S3/FLJ35955/sigma3b
AP3S2
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers