missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AKR1B10 Partial ORF (NP_064695, 76 a.a. - 143 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00057016-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16158946

  • 545.00€ / 25µg

Estimated Shipment: 02-08-2022
to see stock.
Add to basket

Description

Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq]

Sequence: VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
Specifications

Specifications

NP_064695
Liquid
57016
AKR1B10 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AKR1B11/AKR1B12/ALDRLn/ARL-1/ARL1/HIS/HSI/MGC14103
AKR1B10
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.22kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
RUO
AKR1B10
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers