missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human AKR1B10 Partial ORF (NP_064695, 76 a.a. - 143 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00057016-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq]
Sequence: VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWESpecifications
| NP_064695 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.22kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE | |
| RUO | |
| AKR1B10 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 57016 | |
| AKR1B10 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AKR1B11/AKR1B12/ALDRLn/ARL-1/ARL1/HIS/HSI/MGC14103 | |
| AKR1B10 | |
| Recombinant | |
| wheat germ expression system |