missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ADARB1 Partial ORF (AAH65545, 592 a.a. - 701 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000104-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq]
Sequence: PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTPSpecifications
| AAH65545 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP | |
| RUO | |
| ADARB1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 104 | |
| ADARB1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ADAR2/ADAR2a/ADAR2a-L1/ADAR2a-L2/ADAR2a-L3/ADAR2b/ADAR2c/ADAR2d/ADAR2g/DRABA2/DRADA2/RED1 | |
| ADARB1 | |
| Recombinant | |
| wheat germ expression system |