missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ACVRL1 Partial ORF (AAH42637, 22 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000094-Q01.10ug
This item is not returnable.
View return policy
Description
This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq]
Sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLSpecifications
| AAH42637 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL | |
| RUO | |
| ACVRL1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 94 | |
| ACVRL1 (Human) Recombinant Protein (Q01) | |
| 10 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ACVRLK1/ALK-1/ALK1/HHT/HHT2/ORW2/SKR3/TSR-I | |
| ACVRL1 | |
| Recombinant | |
| wheat germ expression system |