missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18258101

Novus Biologicals™ HINT2 Recombinant Protein Antigen

Produktkod. 18258101 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Quantity:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity unitSize
18258101 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18258101 Leverantör Novus Biologicals™ Leverantörsnummer NBP256156PEP
 Restricted Item
Estimated Shipment: 15-10-2026
Lägg i varukorgen
Lägg i varukorgen
Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HINT2. Source: E.coli Amino Acid Sequence: GVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQ The HINT2 Recombinant Protein Antigen is derived from E. coli. The HINT2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gene ID (Entrez) 84681
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name HINT2 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias EC 3.-, HINT-2, HINT-3, histidine triad nucleotide binding protein 2, histidine triad nucleotide-binding protein 2, mitochondrial, HIT-17, HIT-17kDa, PKCI-1-related HIT protein, protein kinase C inhibitor-2
Gene Symbol HINT2
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Research Category Signal Transduction
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50415. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For Research Use Only.

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.