missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HINT2. Source: E.coli Amino Acid Sequence: GVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQ The HINT2 Recombinant Protein Antigen is derived from E. coli. The HINT2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifikationer
Specifikationer
| Gene ID (Entrez) | 84681 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | HINT2 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | EC 3.-, HINT-2, HINT-3, histidine triad nucleotide binding protein 2, histidine triad nucleotide-binding protein 2, mitochondrial, HIT-17, HIT-17kDa, PKCI-1-related HIT protein, protein kinase C inhibitor-2 |
| Gene Symbol | HINT2 |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Visa mer |
For Research Use Only.
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?