missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GST Full-length ORF (AAB37352, 1 a.a. - 242 a.a.) Protein

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ P0002.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161044

  • 350.00€ / 10µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

Sequence: MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Specifications

Specifications

AAB37352
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
GST Full-length ORF (AAB37352, 1 a.a. - 242 a.a.) Protein
12.5% SDS-PAGE Stained with Coomassie Blue
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
GST
GST Tag
AP, Array, ELISA, WB-Re
26.4kDa
Glutathione Sepharose 4 Fast Flow
10μg
RUO
Wheat Germ (in vitro)
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers