Abnova™ GHRL Recombinant Protein

Name: Abnova&trade; GHRL Recombinant Protein
Brand: Abnova&trade;
SKU: 16130333
Price: 508.00 EUR

Marke: Abnova™ H00051738-P01.25ug

Weitere Details : Weight : 0.00010kg

Artikelnummer. 16130333

Menge

Estimated Shipment: 12-06-2024
to see stock.

Zum Warenkorb hinzufügen

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Accession Number	AAH25791.1
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	38.61
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Gene Alias	MTLRP/obestatin
Gene Symbol	GHRL
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	51738
Name	GHRL (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	GHRL
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Produktvorschläge

Beschreibung