missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FSTL1 (Human) Recombinant Protein

Human FSTL1 partial ORF ( NP_009016.1, 209 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00011167-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123826

  • 545.00€ / 25µg

Estimated Shipment: 06-10-2022
to see stock.
Add to basket

Description

Description

  • Sequence: ADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTKRVSTK
Specifications

Specifications

NP_009016.1
follistatin-like 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FSTL1
GST
11167
Wheat germ expression system
25 μg
FLJ50214, FLJ52277, FRP, FSL1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers